SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005051164.1.66865 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005051164.1.66865
Domain Number 1 Region: 165-356
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.24e-86
Family p53 DNA-binding domain-like 0.000000665
Further Details:      
 
Domain Number 2 Region: 545-609
Classification Level Classification E-value
Superfamily SAM/Pointed domain 9.14e-20
Family SAM (sterile alpha motif) domain 0.0000228
Further Details:      
 
Domain Number 3 Region: 392-432
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.00000000000445
Family p53 tetramerization domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005051164.1.66865
Sequence length 679
Comment PREDICTED: tumor protein 63 isoform X1 [Ficedula albicollis]; AA=GCF_000247815.1; RF=representative genome; TAX=59894; STAX=59894; NAME=Ficedula albicollis; AL=Chromosome; RT=Major
Sequence
MNFEAAPFTTLPYYPDPCIQRFVETPSPFSWKESYYRSAMSQSSQPREFLSPEVIQHIWD
FLEQPICSVQPIDLNFIDGPSEDGSTNKIEISMDCVRVQDTELNDPMWPQYTNLGLLNSM
DQQIQNGSSSTSPYNTEHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVS
FQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEV
VKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFT
TVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIR
KQQVSDSTKNGDGTKRPFRQGTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKES
LELMQYLPQHTIETYRQQQQQQHQHLLQKQTSMQSQSSYGSNSPPLSKMNSMNKLPSVSQ
LINPQQRNALTPTTIPDSMGTNIPMMGTHMAMTGDMNGLSPTQALPPPLSMPSTSHCTPP
PPYPSDCSIVSFLARLGCSSCVDYFTTQGLTTIYQIEHYSMDDLVSLKIPEQFRHAIWKG
ILDHRQLHEFSPPHLLRTPSGASTVSVGSGETRGERVIDAVRFTLRQTISFPPRDDWNDF
NFDMDARRNKQQRIKEEGE
Download sequence
Identical sequences U3JY64
XP_005051164.1.66865 ENSFALP00000007718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]