SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005214674.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005214674.1.76553
Domain Number 1 Region: 9-126
Classification Level Classification E-value
Superfamily POZ domain 1.26e-30
Family BTB/POZ domain 0.00046
Further Details:      
 
Domain Number 2 Region: 429-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.45e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005214674.1.76553
Sequence length 589
Comment PREDICTED: zinc finger and BTB domain-containing protein 46 isoform X1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MNNRKEDMEIASHYRHLLRELNEQRQHGVLCDVCVVVEGKVFKAHKNVLLGSSRYFKTLY
CQVQKTSEQATVTHLDIVTAQGFKAIIDFMYSAHLALTSRNVIEVMSAASFLQMTDIVQA
CHDFIKAALDISIKPDASDELEAFEVGAPPGGGADALISAVMAGRSISPWLARRTSPANS
SGDSAIASCHEGGSSYGKEDQEPKTEGPDDLASQPLWPGDVGCGPLHVKEEPLSPAHYGG
SEPPSAMDGTIQNSFSEQTAGDGWQPTGRRKNRKNKDTVRHITQQVEEDSRAGSPLPSFL
PTSGWPFSSRDSNADLTIAEASSSDSRGERPEFLAHVDEGLLGGEGSYLGAPLTPEKDDA
LHQATAVANLRAALMSKNSLLALKADVLGEDSSLLLEYLPKGAHSLSLNEFTVIRKKFRC
PYCSFSAMHQCILKRHMRSHTGERPYPCEICGKKFTRREHMKRHTLVHSKDKKYVCKLCS
RVFMSAASVGIKHGSRRHGVCADCAGGGGAGSLDGGGAEGSPELFAGDGPYLEDPEDPRG
EGEEELGEDEDDVGLAPEDTLLGDKEDDDSPRGPHSPTGGADKDFAWIS
Download sequence
Identical sequences E1BM43 L8HN76
NP_001179093.1.59421 NP_001179093.1.76553 XP_005214671.1.76553 XP_005214673.1.76553 XP_005214674.1.76553 XP_005214675.1.76553 XP_005911391.1.15283 XP_010834860.1.44457 XP_010834861.1.44457 ENSBTAP00000022163 ENSBTAP00000022163 9913.ENSBTAP00000022163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]