SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005451007.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005451007.1.78416
Domain Number 1 Region: 22-226
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.84e-55
Family Ankyrin repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 240-284
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000392
Family SOCS box-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005451007.1.78416
Sequence length 289
Comment PREDICTED: ankyrin repeat and SOCS box protein 13 isoform X1 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MEITRARPSLYGEIAHGLGFWTDRSAVHEAAAQGRAFQLQQLIEGGAAVNIVAVDSITPL
HEACIQGQAQCVRLLLDAGAQVDARNIDGSTPLCDACAAGSLDCVKLLLEYGATVNPPLF
TFSPLHEACMGGNSDCVQLMIDQGAHMEAHDCHYGTPLHVACARQHYDCAKVLLNAGANV
NAAKLHETALHHAAKAKNTDLIELLVEFGGNVYARDNLNKKPIHYTTLGSPSYLCLEFFE
NNPLSLQQLSRVAVRRILGRRAHKVVSRLDLPNRIISFLSYIPAPVIEI
Download sequence
Identical sequences XP_005451007.1.78416 XP_005451008.1.78416 XP_005451009.1.78416 XP_005451011.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]