SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005473402.1.78416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005473402.1.78416
Domain Number 1 Region: 36-126
Classification Level Classification E-value
Superfamily Kringle-like 5.8e-26
Family Kringle modules 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005473402.1.78416
Sequence length 278
Comment PREDICTED: phosphoinositide-3-kinase-interacting protein 1 [Oreochromis niloticus]; AA=GCF_001858045.1; RF=representative genome; TAX=8128; STAX=8128; NAME=Oreochromis niloticus; AL=Chromosome; RT=Major
Sequence
MLSVKSARQLCKVFFSLHVVFLSVALVESRASNGDQKDCVRSNGVDYRGEQQNSSSGLSC
LIWTNTTRDYDVTIHPDSEKGVGDHNYCRNPDASERPWCYIAGPDGAIQRESCALETCKE
QTSFVLAKTESLSTKATTPSTESAQPAKASRGDVPALQPVMGISQRVHTGPKKKKDLGTI
GYVLAIIMMGIIIVLGVGITLGYFYKRGRDLKKQHEQRVYEREMQRITLPLSAFSNPTCE
LVDENTIVITAEHETTPVQDDADGGDPLMAQQAGTPGA
Download sequence
Identical sequences XP_005473402.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]