SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005590972.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005590972.1.63531
Domain Number 1 Region: 94-204
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 3.53e-42
Family FAD-dependent thiol oxidase 0.000000756
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005590972.1.63531
Sequence length 205
Comment PREDICTED: FAD-linked sulfhydryl oxidase ALR isoform X1 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MAAPGERGSFHGRNLFFLPGGARSEVMDDLATDARGRGAGRRDAATSAPTPAQAPTSESP
VAVDASRRRPCRACVDFKTWMRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDL
PTPEQQQDMAHFIHLFSKFYPCEECAEDLRERLCRNQPDTRTRAGFTQWLCHLHNEVNRK
LGKPDFDCSKVDERWRDGWKDGSCD
Download sequence
Identical sequences A0A1D5QA16 A0A2K5WXL1 A0A2K6E510
ENSMMUP00000010438 XP_001082639.1.72884 XP_005590972.1.63531 XP_011746657.1.29376 9544.ENSMMUP00000010438 ENSMMUP00000010438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]