SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005615050.2.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005615050.2.31192
Domain Number 1 Region: 12-117
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 3.14e-44
Family Nucleoplasmin-like core domain 0.0000037
Further Details:      
 
Weak hits

Sequence:  XP_005615050.2.31192
Domain Number - Region: 160-187
Classification Level Classification E-value
Superfamily ARM repeat 0.00127
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005615050.2.31192
Sequence length 294
Comment PREDICTED: nucleophosmin isoform X1 [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE
EDAESEDEEEEDVKLLSISGKRSAPGSGSKVPQKKVKLAADEDDDDEDDDEDDDEDDDDD
DFDEEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSTPRSKGQESFKKQEKTPKTPKG
PSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
Download sequence
Identical sequences F6X9D3
9796.ENSECAP00000019566 ENSECAP00000019566 XP_005615050.2.31192 XP_008507914.1.77740 XP_014641594.1.5094 XP_014706356.1.49734 ENSECAP00000019566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]