SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005626657.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005626657.1.84170
Domain Number 1 Region: 11-153
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 8.9e-47
Family Nucleoside diphosphate kinase, NDK 0.00021
Further Details:      
 
Weak hits

Sequence:  XP_005626657.1.84170
Domain Number - Region: 158-194
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0968
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005626657.1.84170
Sequence length 211
Comment PREDICTED: nucleoside diphosphate kinase homolog 5 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MELSMPPPQIYVEKTLAIIKPDIADKEEEIQDIILRSGFTIVQRRKLHLSPEHCSNFYVE
QYGKMFFPNLTAYMSSGPLVAMILARHKAISYWKELLGPTNTLVAKETHPDSLRAIYGTD
DLRNALHGSNDFAAAEREIQFMFPDVIIEPIPVGQAAKDYLNLYVTPTLLQGLTTLCKEK
PADPFIWLADWLLKNNPNKPKLCHNPAAEEP
Download sequence
Identical sequences E2RLI0
XP_003639426.1.84170 XP_005626657.1.84170 9615.ENSCAFP00000001656 ENSCAFP00000001656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]