SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005746549.1.53837 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_005746549.1.53837
Domain Number - Region: 22-98
Classification Level Classification E-value
Superfamily TAZ domain 0.0824
Family TAZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005746549.1.53837
Sequence length 144
Comment PREDICTED: protein cornichon homolog 1 [Pundamilia nyererei]; AA=GCF_000239375.1; RF=representative genome; TAX=303518; STAX=303518; NAME=Pundamilia nyererei; AL=Scaffold; RT=Major
Sequence
MAFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPLVLPEYLIHF
FFCVMFFCAAEWLTLCLNLPLLAYHVWRYMSRPVMSCPGLYDPTTIMNADILAYCQKEGW
CKLAFYLLSFFYYLYGMIYVLVSS
Download sequence
Identical sequences I3KU48
XP_003445501.1.78416 XP_004539980.1.88231 XP_005746549.1.53837 XP_005934049.1.24487 XP_006798634.1.46954 XP_008283764.1.38333 XP_018537230.1.34915 XP_019962519.1.63745 XP_022052805.1.10920 ENSONIP00000024644 ENSONIP00000024644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]