SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005810311.1.87360 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005810311.1.87360
Domain Number 1 Region: 7-49
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000175
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005810311.1.87360
Sequence length 134
Comment PREDICTED: EF-hand calcium-binding domain-containing protein 10-like [Xiphophorus maculatus]; AA=GCF_000241075.1; RF=representative genome; TAX=8083; STAX=8083; NAME=Xiphophorus maculatus; strain=JP 163 A; AL=Scaffold; RT=Major
Sequence
MATKRERDATAYLKKHKIVELMDNMTSMLLFYRPENPKEFLIEQLDLLKVSRESGIRGPN
LFDNSNLTAVCGIMDPANQKYISFAQYKQALTMLGIKDININPEGRAKDKISHETFKTEA
MEVLKRDSATYAKY
Download sequence
Identical sequences M4ADC0
XP_005810311.1.87360 ENSXMAP00000012464 ENSXMAP00000012464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]