SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005954733.1.78601 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005954733.1.78601
Domain Number 1 Region: 105-165
Classification Level Classification E-value
Superfamily BPTI-like 6.95e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005954733.1.78601
Sequence length 169
Comment PREDICTED: trophoblast Kunitz domain protein 1-like isoform X1 [Pantholops hodgsonii]; AA=GCF_000400835.1; RF=representative genome; TAX=59538; STAX=59538; NAME=Pantholops hodgsonii; AL=Scaffold; RT=Major
Sequence
MNRLCLSAALLFLLVILVYSTPVYEHHAQDQGLETSHGRRPEKRSIIDVISHVIDGVVKG
TKIFHGLKGLADIISNGIQGQVMISGTQLENHTAEEFLTQILKYEASKPEFCLEPELKGP
CKDQMTRYFYNATAGYCEPFVYGGCEGNKNNFQTLSDCIVTCSPVTVSL
Download sequence
Identical sequences XP_005954733.1.78601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]