SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006095953.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006095953.1.53796
Domain Number 1 Region: 542-712
Classification Level Classification E-value
Superfamily Sec7 domain 3.53e-55
Family Sec7 domain 0.0000369
Further Details:      
 
Domain Number 2 Region: 750-871
Classification Level Classification E-value
Superfamily PH domain-like 7.35e-26
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006095953.1.53796
Sequence length 1024
Comment PREDICTED: PH and SEC7 domain-containing protein 1 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MAQGAMRFCSEGDCAISPPRCPRRWLPEGPVPQSPPASMYGSTGSLLRRVAGPGPRGREL
GRVTAPSTPLRGPPSPRVAPSPWAPSSPTGQPPPGARSSVVIFRFVEKASVRPLNGLPAP
GGLSRSWDLGGVAPPRPTPALGPGSNRKLRLEASTSDPLPAGGGSALPGSQGLLHGPPAP
PQVRADGLYSSLPNGLGGPSEHLATLFRGPADTGLLNQGDTWSSPREVSSHAQRIARAKW
EFFYGSLAPPSSGAKPPEQAPPSPPGVGSGQGSGVAVGRAAKYSETDLDTVPLRCYRETN
IDEVLAEREEADSAIESQPSSEGLPGTVRPPAPRPGPCLGPHASLSSGDEDEAGGEEDVD
DEVFEASEGARPGTQMPHLGPLKSPVPFLPGTSPSADGPDSFSCVFEAILESHRAKGTSY
TSLASLEALASPGPTQSPFFTFELPPQPPIPRPDPPVPAPLAPLEPDSGTSSAADGPWTQ
RGEEEEAEAAAKQAPGKEPPSPCRSEDSFGLGVAPLGSEPPLSQLVSDSDSELDSTERLA
LGSTDTLSNGQKADLEAAQRLAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFFVF
TGMTLDQALRVFLKELALMGETQERERVLAHFSQRYFQCNPGALSSEDGAHTLTCALMLL
NTDLHGHNIGKRMTCGDFIGNLEGLNEGGDFPRELLKALYSSIKNEKLQWAIDEEELRRS
LSELADPNPKVIKRVSGGSGSGSSPFLDLTPEPGAAVYKHGALVRKVHADPDCRKTPRGK
RGWKSFHGILKGMILYLQKEEYQPGKALSEAELKNAISIHHALATRARDYSKRPHVFYLR
TADWRVFLFQASSLEQMQSWITRINVVAAMFSAPPFPAAVSSQKKFSRPLLPSAATRLSQ
EEQVRTHEAKLKAMASELQEHQAALLGKKARGKEAEEQRQKEAYLEFEKSRYGTYAALLR
VKLKAGSEELDVVEAALAQAGSTEDGVLPPHSSPALQRNVSSQPRAQCHGSEPRAGAGSG
RRKP
Download sequence
Identical sequences G1P6Q5
XP_006095953.1.53796 XP_006095954.1.53796 ENSMLUP00000005760 ENSMLUP00000005760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]