SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006129735.1.96668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006129735.1.96668
Domain Number 1 Region: 22-247
Classification Level Classification E-value
Superfamily L domain-like 5.39e-41
Family Ngr ectodomain-like 0.015
Further Details:      
 
Domain Number 2 Region: 268-362
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 398-471
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000128
Family Fibronectin type III 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006129735.1.96668
Sequence length 677
Comment PREDICTED: leucine-rich repeat and fibronectin type-III domain-containing protein 4 [Pelodiscus sinensis]; AA=GCF_000230535.1; RF=representative genome; TAX=13735; STAX=13735; NAME=Pelodiscus sinensis; AL=Scaffold; RT=Major
Sequence
MACLLLVLLLMAGTLVSWAASCPFHCVCQNLSESLSTLCANKGLLFIPANIDRRTVELRL
ADNYIRVLEPHDFLNMSGLVDLTLSRNTIDSIRPFAFGDLESLRSLHLDGNRLMEIGEEA
LRGMLNLQHLILNNNQLDDSLLTLEDLDLSYNNLRRVPWEGIRGMVYLHTLNLDHNLIDS
IMEGTFSELYKLSRLDMTSNRLYTLPPDPLFARSQMGVISPTPYTATIVLSFGGNPLHCN
CELLWLGRLAGEDGRYFWSVPEEEFTCEPPLITRHTHKLWVLEGQRATLKCRAIGDPEPV
IHWVSPDDKIISNSSRTISFRNGTLDVLVTTVRDDGPYTCIAINAAGESTALVDLKIIPL
PHRGNGSSSTVLRHDPGSSDIATKTAANTTDLGVGERSVEVSDVTADSALVHWAMDRSTH
TAWMYQIQYNCTVDDTLIYRIIPASSRHFVLKHLVAGVDYNLCVLAIFDDAATSLAATHL
LGCAQFSTQEAYPDCHSLHAHFLGGTLTVIVGGIIVVTLLVFTVVMMVKYKFCGSAHSGM
PKVSNMYSQTNGGQPGVLNGMLPQRGPQRERGPKVQRRRARGKPARQEALERRTAEGVVA
CPGDLPELGTSKAKRSCSLDMGEISASACYGYAKRLSIMWTKRSQSVHGMLANCTAEGED
KRDGALASADELEESVV
Download sequence
Identical sequences K7F4Q3
XP_006129735.1.96668 ENSPSIP00000003013 ENSPSIP00000003013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]