SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006278463.1.47583 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006278463.1.47583
Domain Number 1 Region: 137-277
Classification Level Classification E-value
Superfamily ISP domain 3.93e-38
Family Rieske iron-sulfur protein (ISP) 0.00000161
Further Details:      
 
Domain Number 2 Region: 84-151
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 4.14e-22
Family ISP transmembrane anchor 0.000096
Further Details:      
 
Domain Number 3 Region: 1-35
Classification Level Classification E-value
Superfamily Non-globular alpha+beta subunits of globular proteins 0.0000144
Family Ubiquinol-cytochrome c reductase 8 kDa protein 0.0024
Further Details:      
 
Domain Number 4 Region: 47-82
Classification Level Classification E-value
Superfamily Non-globular alpha+beta subunits of globular proteins 0.0000915
Family Ubiquinol-cytochrome c reductase 8 kDa protein 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006278463.1.47583
Sequence length 278
Comment PREDICTED: cytochrome b-c1 complex subunit Rieske, mitochondrial [Alligator mississippiensis]; AA=GCF_000281125.3; RF=representative genome; TAX=8496; STAX=8496; NAME=Alligator mississippiensis; AL=Scaffold; RT=Major
Sequence
MLSVAARAGPLGPFLCAVAHGVPGPLKQLVPGVVVPALPEPAGGLRLHAMRNLLGRDPPG
GRAARGGLVATASLNAPASVRFVHNDVTVPDFSDYRHPAVLDSTKSSQDSGDARRGFSYL
MTATACVTTAYVAKNFVTQFIYSLSAAADVIAMSKVEIKLLDIPEGKNMTFKWRGKPLFV
RHRTQDEINQEAAVNLAELRDPQHDLERVKKPEWLILVGVCTHLGCVPIAGAGEFGGYYC
PCHGSHYDLSGRIRKGPAPLNLEIPYYEFTSDDLVIVG
Download sequence
Identical sequences A0A151N6V1
XP_006278463.1.47583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]