SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006347420.1.80749 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006347420.1.80749
Domain Number 1 Region: 196-300
Classification Level Classification E-value
Superfamily TAZ domain 7.85e-19
Family TAZ domain 0.00085
Further Details:      
 
Domain Number 2 Region: 26-119
Classification Level Classification E-value
Superfamily POZ domain 0.000000000126
Family BTB/POZ domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006347420.1.80749
Sequence length 349
Comment PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum tuberosum]; AA=GCF_000226075.1; RF=representative genome; TAX=4113; STAX=4113; NAME=Solanum tuberosum; cultivar=DM 1-3 516 R44; AL=Scaffold; RT=Major
Sequence
MSPNMFASNVDAHHGENEMAEGDVDIITSAGRRIPAHSNVLAAASTVLESILGRWRRSYE
TPIRILGVPCDSVSVFVRFLYSFKCTKEQMEKHGIHLLALSHVYLVPCLKHRCTKALAEQ
LTIENVIDMIQLARLCDAPHLYLKCMKFLRSNFKKVEETEGWKFLQHHDPLLELEILQFT
DEAELRKKRRRRHTQEQNLYLQLSEGMDCLEHICREGCTSVGPYDEEYSCQKKLPCSKFD
TCQGLQLLIRHFSTCKRRVKGSCFQCKRMWQLLRLHASICDQPDDCRVPLCREFKQKLEK
RGDDELWKSLVRKVVSARAMTFLSLPKRKREEEEPRLNLRDHQIRRFLD
Download sequence
Identical sequences M1CKD8
XP_006347420.1.80749 PGSC0003DMP400046847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]