SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006377749.1.11743 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006377749.1.11743
Domain Number 1 Region: 58-152,180-197
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.68e-30
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 
Weak hits

Sequence:  XP_006377749.1.11743
Domain Number - Region: 363-391
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00628
Family Pan module (APPLE domain) 0.065
Further Details:      
 
Domain Number - Region: 327-359
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.0929
Family EB1 dimerisation domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006377749.1.11743
Sequence length 415
Comment hypothetical protein POPTR_0011s11160g [Populus trichocarpa]; AA=GCF_000002775.3; RF=representative genome; TAX=3694; STAX=3694; NAME=Populus trichocarpa; AL=Chromosome; RT=Major
Sequence
MLDLRCIVRKDSTVPPSSRFKEVNTGDFAEALSEYSSDFRGLDLSVSIFQLCFYNTTPNA
FTLAIRMGTRRSPAMRRFVWEANRGNPVGEDATLTFGEDGNLILADADGRVAWQTNTANK
GVVGLQMLTNGNMVLHDSKGNFIWQSFDYPTDTLLVGQPLRVGGVTRLVSRASDKQNTNG
AYSLVLEPERLAMYYKSPNSPKPYVYYTFSKQKGRLQYVRLSKTPNSQALSLEFSTGART
LLSRPKFNSTMSFLRLGVDGNLRVYTFNDKLTSASWEVTFTLFSRDARIWESECQLPQKC
GKFGLCEDSRCVSCPLPTGFRKWTKKCEPVKSSVCNKNFYYYKLEGVDHSMSKYGDGSGP
MKKTDCEKKCSGDCKCSGYFYNTKTSMCWIAYDLQTLTKVANPTHVGYVKVPNHQ
Download sequence
Identical sequences U5G036
POPTR_0011s11160.1|PACid:18231085 XP_006377749.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]