SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006392371.1.70970 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006392371.1.70970
Domain Number 1 Region: 255-414
Classification Level Classification E-value
Superfamily eEF1-gamma domain 9.29e-61
Family eEF1-gamma domain 0.0000508
Further Details:      
 
Domain Number 2 Region: 73-213
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.67e-29
Family Glutathione S-transferase (GST), C-terminal domain 0.0061
Further Details:      
 
Domain Number 3 Region: 2-83
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.24e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006392371.1.70970
Sequence length 414
Comment hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]; AA=GCF_000478725.1; RF=representative genome; TAX=72664; STAX=72664; NAME=Eutrema salsugineum; AL=Scaffold; RT=Major
Sequence
MALVLHTYKGNKGAYKALIAAEYVGVKIEEPSNFQMGVTNKSPEFLKMNPIGKVPVLETP
EGPIFESNAIARYVSRLNGENSLNGSSLIDYAHIEQWIDFATLEIDANMLRWFAPRMGFA
PFSAPAEEAAIAGLNRGLDALNTHLASNTYLVGHSVTLADIVTICNLNLGFATVMTKSFT
SAFPHVERYFWTMVNQPNFKKVIGDAKQTEAVPPVPSKKAAQPAKPKEEPKKAAPVAEAP
KPVAEEEEAPKPKAKNPLDLLPPSPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYS
LWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGP
EIPKFIMDEVYDMELYEWTKVDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK
Download sequence
Identical sequences V4MEH0
XP_006392370.1.70970 XP_006392371.1.70970 Thhalv10023493m|PACid:20201476 Thhalv10023494m|PACid:20201477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]