SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006412493.1.70970 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_006412493.1.70970
Domain Number - Region: 14-78
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 0.00876
Family Kix domain of CBP (creb binding protein) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006412493.1.70970
Sequence length 256
Comment hypothetical protein EUTSA_v10026043mg [Eutrema salsugineum]; AA=GCF_000478725.1; RF=representative genome; TAX=72664; STAX=72664; NAME=Eutrema salsugineum; AL=Scaffold; RT=Major
Sequence
MPRPGPRPYDCIRRAWHSDRHQPMRGLLIQEIFRIVCEIHSQSTKKNTEWQEKLPVVVLR
AEEIMYSKANSEAEYMDLNTLLDRTNDAINTIIRLDETTETGEFLQPCIEAALHLGCTPR
RASRSQRNINPRCYLSQQDSTNLENILSPQQYQVFMKPNNFAPKNLTFHNQDKCPVSKYS
AYPLCYSFRVPSSPISNNVTASCKPKNRPATASVIDATNGITFGGCDLSLRLGPLGDVRT
PSQKRCKISSSNDNKS
Download sequence
Identical sequences V4P3F6
Thhalv10026043m|PACid:20195801 XP_006412493.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]