SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006488756.1.29302 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006488756.1.29302
Domain Number 1 Region: 2-109
Classification Level Classification E-value
Superfamily SRP19 3.92e-36
Family SRP19 0.0000953
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006488756.1.29302
Sequence length 136
Comment PREDICTED: signal recognition particle 19 kDa protein [Citrus sinensis]; AA=GCF_000317415.1; RF=representative genome; TAX=2711; STAX=2711; NAME=Citrus sinensis; cultivar=Valencia; AL=Chromosome; RT=Major
Sequence
MDAQTARIKKWVILYPVYINSKKTIAEGRRISASKACENPTCIEIADCCQYLKIPHAIEI
DKAYPRDFMQRGRVRVMLKREDGTFVNPAISSRKQLMLHVAELVPRHPNRTKKQEPASTS
SNAGPSKSGKSGKKKR
Download sequence
Identical sequences A0A067G9R7
orange1.1g032659m|PACid:18109622 XP_006488756.1.29302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]