SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006682405.1.45406 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006682405.1.45406
Domain Number 1 Region: 164-341
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.44e-37
Family Nucleotide and nucleoside kinases 0.00000392
Further Details:      
 
Domain Number 2 Region: 735-911
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.58e-35
Family Nucleotide and nucleoside kinases 0.00000636
Further Details:      
 
Domain Number 3 Region: 542-719
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.9e-33
Family Nucleotide and nucleoside kinases 0.00000865
Further Details:      
 
Domain Number 4 Region: 351-527
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.34e-33
Family Nucleotide and nucleoside kinases 0.00000463
Further Details:      
 
Weak hits

Sequence:  XP_006682405.1.45406
Domain Number - Region: 17-56
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000262
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006682405.1.45406
Sequence length 928
Comment hypothetical protein BATDEDRAFT_28095 [Batrachochytrium dendrobatidis JAM81]; AA=GCF_000203795.1; RF=representative genome; TAX=684364; STAX=109871; NAME=Batrachochytrium dendrobatidis JAM81; strain=JAM81; AL=Scaffold; RT=Major
Sequence
MSTNWFLNDELSTDSCKYFEEQRMRQILESIVAGITYNKPSDPLEYMECCIQKIRANELL
SAQPTLRWDTFLPPIVLLSRNSRQDSIVVRKSKIGNTVLPRISTTHAHQSNEHQAPSLIT
EIGVQKRISIVLPPIQSATDRAFKDTSITTTPQITSRGQAWNNIVFVLGGPGSGKGTQCV
RIAKEFNYTHLSAGDLLRNEVATGSSLGKQLDSMMKEGKIVPTDITLRLLTEAMETAPAA
KGFLIDGFPRQLDQAEAFESKIARCRFVLYFECSESVLEQRLLERGKSSGRADDNMETIK
KRFHTFVETSYPVIEFFKNAGRCFKISSEQSPDEVYDEVQQCFVDPPLYHPNIVFILGGP
GSGKGTQCERLVKEFQLTHLSAGDLLRGEVERGTEVGILASELMKEGKIVPMDLILSLLR
KEIEKNIASIGFLIDGFPRAMDQALEFEKTIGPCRAVLAFTCSLPVLEQRLLERGKTSGR
ADDNLDTIKKRFHTFNEQSLPVIEYYKSKGKCVEISSENAIDRVYDDARLVFIPPEPLHH
PNLVFILGGPGSGKGTLCEKIVKEFDFIHISTGDLLRREIENKTAIGQLVEQCILVGAMA
PSHIILELLIREIMGNFAAPGFLIDGFPRAMDQALNFERVVGSPKFVLFLECPLNILEKR
LVERGRTSGRADDNIDTIRKRFITYHDESLPVIRYYTSKSIALKISSIRAPDEVFDQVKV
NFAYMKTKQPFEGQLIIFVLGGPGSGKGTQCDRLVAKYGLTHLSTGDLLRDEVKKGSPLG
AQLESDMTQGKMVSMEVIMKLLLAEMNQKKDGPGYLIDGFPRTIEQAHLFESVIGRCTFV
LYFEASNEILTTRLLKRGETSGRADDNLESIGKRLVTFENASLPVIRYYERTNRVKKINS
EAHVDEVTAKTVLLFEENHTFSTTKDLQ
Download sequence
Identical sequences A0A177WXU3 F4PCT8
XP_006682405.1.45406 jgi|Batde5|28095|fgenesh1_pg.C_scaffold_16000125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]