SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006735518.1.47382 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006735518.1.47382
Domain Number 1 Region: 12-117
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 6.67e-43
Family Nucleoplasmin-like core domain 0.00000442
Further Details:      
 
Domain Number 2 Region: 158-188
Classification Level Classification E-value
Superfamily ARM repeat 0.0000978
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006735518.1.47382
Sequence length 266
Comment PREDICTED: nucleophosmin isoform X2 [Leptonychotes weddellii]; AA=GCF_000349705.1; RF=representative genome; TAX=9713; STAX=9713; NAME=Leptonychotes weddellii; AL=Scaffold; RT=Major
Sequence
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEERNYKGSPIKVTMATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE
EDAESEDEEEEDVKLLSISGKRSAPGSGSKVPQKKVKLAADEDDDEDDDDDDDDEDDDDD
DFDDEEAEEKAPVKKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKF
INYVKNCFRMTDQEAIQDLWQWRKSL
Download sequence
Identical sequences XP_006735518.1.47382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]