SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006802467.1.46954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006802467.1.46954
Domain Number 1 Region: 5-118
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 2.14e-33
Family Rap30/74 interaction domains 0.0000106
Further Details:      
 
Domain Number 2 Region: 176-242
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.89e-22
Family DNA-binding domain from rap30 0.0000767
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006802467.1.46954
Sequence length 252
Comment PREDICTED: general transcription factor IIF subunit 2-like [Neolamprologus brichardi]; AA=GCF_000239395.1; RF=representative genome; TAX=32507; STAX=32507; NAME=Neolamprologus brichardi; AL=Scaffold; RT=Major
Sequence
MSETMEVDLTGVKQSKGVWLVKVPKYLSQQWDKAAEKGEVGKITIGKKQGKTEVCFSLSD
ELIALDAVGENDASLEVPKDHPFTMHPVGGQTMAVFSHSNTDEISLEGMVVHRAECRPVV
TDSYMKLKKLQIKESIKPQRLSQQLERAVTTIFKPVANHDFNVEYEKKKKTEGKMVRAER
QLVLDMLFSAFEKHQYYNIKALVDITKQPVTYLKEIMREIGTYNSKGVHKSTWELKPEYR
HYQSDEEEMQTT
Download sequence
Identical sequences XP_006802467.1.46954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]