SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006884405.1.29581 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006884405.1.29581
Domain Number 1 Region: 12-117
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 2.49e-44
Family Nucleoplasmin-like core domain 0.0000037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006884405.1.29581
Sequence length 266
Comment PREDICTED: nucleophosmin isoform X2 [Elephantulus edwardii]; AA=GCF_000299155.1; RF=representative genome; TAX=28737; STAX=28737; NAME=Elephantulus edwardii; AL=Scaffold; RT=Major
Sequence
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE
EDAESDDEEEEDVKLLSISGKRSAPAGGNKIPQKKVKLATDEEDDDDDDDDDEDEDDDDD
EFDDDEAEEKAPVKKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKF
INYVKNCFRMTDQEAIQDLWQWRKSL
Download sequence
Identical sequences XP_006884405.1.29581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]