SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006965065.1.9351 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006965065.1.9351
Domain Number 1 Region: 2-111
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 6.67e-45
Family FAD-dependent thiol oxidase 0.0000059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006965065.1.9351
Sequence length 112
Comment predicted protein, partial [Trichoderma reesei QM6a]; AA=GCF_000167675.1; RF=representative genome; TAX=431241; STAX=51453; NAME=Trichoderma reesei QM6a; strain=QM6a; AL=Scaffold; RT=Major
Sequence
DCPPDVETLGRSTWTLLHTIAATYPEQPSRTQQSDLLSFVGLFSKLYPCWVCAEDFQGYL
ARQKPQVSSREEFSQWLCRAHNDVNRKLGKPEFDCSRVDERWRTGWKDGRCD
Download sequence
Identical sequences G0RHV2
jgi|Trire2|60849|e_gw1.8.368.1 XP_006965065.1.9351 51453.JGI60849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]