SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007275669.1.4750 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007275669.1.4750
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 8.24e-21
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00016
Further Details:      
 
Domain Number 2 Region: 78-169
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.98e-20
Family Cold shock DNA-binding domain-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007275669.1.4750
Sequence length 171
Comment RNA polymerase ii subunit 7 [Colletotrichum gloeosporioides Nara gc5]; AA=GCF_000319635.1; RF=representative genome; TAX=1213859; STAX=474922; NAME=Colletotrichum gloeosporioides Nara gc5; strain=Nara gc5; AL=Scaffold; RT=Major
Sequence
MFFLYNMERRVTLHPSYFGRNMHELVTSKLLKDVEGTCAGSYYIISIMDTFDISEGRILP
GSGLAEFTVGYRAVVWRPFKGETVDAVVYSVNHQGFFAQAGPLRLFVSAHLIPSEIKWDP
NATPPQFTNNEDTIIEPGTHVRVKVIGTRTEVGEMWAIGSIKEDYLGCLQD
Download sequence
Identical sequences A0A010RWQ6 A0A066X678 A0A135SP63 A0A135SPQ7 A0A135U815 A0A166RDR4 A0A167A1X8 A0A1G4BJ21 A0A1Q8RVK1 E3Q6K6 H1VHL3 L2G9D8 T0LES9
EFQ26454 XP_007275669.1.4750 XP_007591441.1.78992 XP_008090474.1.39555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]