SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007595094.1.78992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007595094.1.78992
Domain Number 1 Region: 96-232
Classification Level Classification E-value
Superfamily ISP domain 1.52e-39
Family Rieske iron-sulfur protein (ISP) 0.00000218
Further Details:      
 
Domain Number 2 Region: 50-106
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 7.41e-17
Family ISP transmembrane anchor 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007595094.1.78992
Sequence length 233
Comment cytochrome b-c1 complex subunit Rieske [Colletotrichum fioriniae PJ7]; AA=GCF_000582985.1; RF=representative genome; TAX=1445577; STAX=710243; NAME=Colletotrichum fioriniae PJ7; strain=PJ7; AL=Scaffold; RT=Major
Sequence
MAPLAQVSRTCLRQLARTSPSTAARALSTSAARNDSTATSYSSPFKGAQKGSSIPDFSKY
MSKGSAGTNQLFGYFMVGTMGAITAAGAKSTVQEFLVNMSASADVLAMAKVEVDLSTIPE
GKNVIIKWRGKPVFIRHRTQSEIDEANKVSVSSLRDPQKDDDRVKTPEWLIMLGVCTHLG
CVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPEYDFPEDGKLVIG
Download sequence
Identical sequences A0A010RT83
XP_007595094.1.78992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]