SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007797236.1.6650 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_007797236.1.6650
Domain Number - Region: 14-45
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 0.00693
Family Small-conductance potassium channel 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007797236.1.6650
Sequence length 230
Comment putative doa4-independent degradation protein 4 protein [Eutypa lata UCREL1]; AA=GCF_000349385.1; RF=representative genome; TAX=1287681; STAX=97096; NAME=Eutypa lata UCREL1; strain=UCREL1; AL=Scaffold; RT=Major
Sequence
MNILEWAFGKRMTPAERLRKNQRMLDKAIRELDQVRVKLEKQEKTLVTQIRQSAQKGQMG
AAKIQAKDLVRTRRYVEKFYGMRSQLQKISLRLQTHRTNEQMMQAMKGATMALGSMNRSM
NLPALQRIAMEFERENDIMEQRQEMMDDAVDDAMDAGLEEEGDEVVEQVLEEIGVDLNQA
FGETPTGLQVEKAPEGRIAQAIGGPSGGGGGGGGDPGDDDLQARLDSLRK
Download sequence
Identical sequences M7SHS2
XP_007797236.1.6650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]