SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007827481.1.2009 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007827481.1.2009
Domain Number 1 Region: 28-96
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 9.02e-24
Family Hydrophobin II, HfbII 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007827481.1.2009
Sequence length 98
Comment hypothetical protein PFICI_00709 [Pestalotiopsis fici W106-1]; AA=GCF_000516985.1; RF=representative genome; TAX=1229662; STAX=393283; NAME=Pestalotiopsis fici W106-1; strain=W106-1; AL=Scaffold; RT=Major
Sequence
MQYLTLAALFAAVLAAPSAIQQRQTYEACSGLYSTAQCCATDVAGVADLDCQNPPETLVN
ATQFQDVCASVGQRARCCVLPVGGIVDVLCETPTGVTD
Download sequence
Identical sequences W3XNP2
XP_007827481.1.2009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]