SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007993170.1.81039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007993170.1.81039
Domain Number 1 Region: 344-415
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.9e-23
Family C-terminal domain of the rap74 subunit of TFIIF 0.0000366
Further Details:      
 
Domain Number 2 Region: 7-66
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 4.71e-21
Family Rap30/74 interaction domains 0.0000211
Further Details:      
 
Domain Number 3 Region: 69-170
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.000000105
Family Rap30/74 interaction domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007993170.1.81039
Sequence length 415
Comment PREDICTED: general transcription factor IIF subunit 1 isoform X1 [Chlorocebus sabaeus]; AA=GCF_000409795.2; RF=representative genome; TAX=60711; STAX=60711; NAME=Chlorocebus sabaeus; AL=Chromosome; RT=Major
Sequence
MTVAPCRFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEE
EWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLEMSSDASD
ASGEEGGRAPKAKKKVPLAKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQ
DEPESKAKPPQQEEGPKGVDEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSS
EESDSSEESDIDSEASSALFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGSSTSSTLR
AAASKLEQGKRVSEMPVAKRLRLDAGPQSLSGKSTPQPPSGKSTPSSGDVQVTEDAVRRY
LTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMVNDKMHFSLKE
Download sequence
Identical sequences XP_007993170.1.81039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]