SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008001199.1.81039 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008001199.1.81039
Domain Number 1 Region: 137-406
Classification Level Classification E-value
Superfamily EndoU-like 2.49e-95
Family Eukaryotic EndoU ribonuclease 0.00000593
Further Details:      
 
Domain Number 2 Region: 21-63
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000000196
Family Somatomedin B domain 0.0012
Further Details:      
 
Domain Number 3 Region: 88-128
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000301
Family Somatomedin B domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008001199.1.81039
Sequence length 411
Comment PREDICTED: poly(U)-specific endoribonuclease [Chlorocebus sabaeus]; AA=GCF_000409795.2; RF=representative genome; TAX=60711; STAX=60711; NAME=Chlorocebus sabaeus; AL=Chromosome; RT=Major
Sequence
MRACIPLVLAVLCSLAWAGKMESCASRCNEKFNRDAACQCDRRCLRHGNCCEDYEHLCTE
DHKESEPLPQPEEETEEALASNLYSAPTSCRGRCYEAFDKHHQCHCNARCQEFGNCCKDF
ESLCSDHEGFSHSSDAITKEEIQSISEKIYRADTNKAQKEDIILNSQNCISPSETRDQRD
RCPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAV
MKELYSFLHHQNRYGSEQEFIDDLKNMWFGLYSRGNEEGDSSGFEHVFSGEVKKGKVTGF
HNWIRFYLEEKEGLVDYYSHVYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFA
LYSLCFIARPGKVCQLSLGGYPLAVRTYTWDKSTYGNGKKYIATAYIVSSA
Download sequence
Identical sequences XP_008001199.1.81039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]