SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008179933.1.67334 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008179933.1.67334
Domain Number 1 Region: 413-625
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.19e-54
Family DBL homology domain (DH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 179-307
Classification Level Classification E-value
Superfamily BRCT domain 3.49e-16
Family DNA topoisomerase II binding protein 1, TopBP1 0.049
Further Details:      
 
Domain Number 3 Region: 122-201
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000363
Family DNA ligase 0.065
Further Details:      
 
Weak hits

Sequence:  XP_008179933.1.67334
Domain Number - Region: 616-731
Classification Level Classification E-value
Superfamily PH domain-like 0.0043
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008179933.1.67334
Sequence length 899
Comment PREDICTED: protein ECT2 [Acyrthosiphon pisum]; AA=GCF_000142985.2; RF=representative genome; TAX=7029; STAX=7029; NAME=Acyrthosiphon pisum; strain=LSR1; AL=Scaffold; RT=Major
Sequence
MSAANGTGQNNYNNNNCDFKEELVKMQSVSSLESELSNVNIYLEKIYSSDLDVLLSIQKL
NVSIKYLENLSDVNLLEKNDILVTTLFEELAVKRPCFKILGRPALLELAKSPNGLQGINR
HRYCNVLVGAIVSVTGIQKRDEMARLLSLIRWMGGSFRESINYKTTHLVSGYACSVKSQY
AYLHEIPVIGSSWLHAAWERRDEIEFKANNTSFFSEHKLKPFHGAKICFIGFTEEEQSHM
VEVLLHNGGTPISNENDTECTHLVVNESSLDSIPSVKKNNAEILKEAWFWISVQYQSCAL
TKEYLLSNVNVTNTPISAHVMSSTLTLNSSRSRKRKRHLDNLGSLLRSSPTPVATIRETS
PTNSSRPSKRRSSAANTLDGLRLSCGSFLNFTNSPDHPSPLKLPRDQDLVIKDKPFSPRY
QVFSELLQTEINYVGVLNTIITVYKEPLEEIIDKKDCLLNNTEIKIIFGNVLPIYQVHRE
MLEELKCLATLWQEDSSIGNVFLKYSSELMKAYPPFVNFFEKTREMLLQCDQTKPLFHAF
LKVGQLRPECCRQSLQELLIRPVQRLPSISLLLNDILKHTDKNNPDHQALISALASIREV
MTHINEDKRKTEGQVVLFDIFNDIDNCPPHLVSSHRSFITKCDVVEQSDNLSGHGDHLTI
FVFSDVVEVCKKKKSCNGKSTKEPNSGSHKFNGGAKSYKHIKLMPLNIIKQVIDIKETED
CHNTFSLLIIDNHDFKEILYKFTMTGSNSGDNHKKIFLKNLSQQVANTVCSGNILTSLDS
QQLDIDTSEITIGTFEKAFKFANRTRIKVGRALSFNKTPSKLKRAVSTMMSPVLSLTYNE
ELGTHPLTPSTQSANMHLASCTNLNDISSDDHTFPSPLMSIQPSRKNKRSILSLSSAPR
Download sequence
Identical sequences J9JW88
XP_008179933.1.67334 XP_016657414.1.67334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]