SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008204470.2.61660 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008204470.2.61660
Domain Number 1 Region: 3-115
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 5.76e-32
Family Nucleoplasmin-like core domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008204470.2.61660
Sequence length 161
Comment PREDICTED: nucleoplasmin-like protein [Nasonia vitripennis]; AA=GCF_000002325.3; RF=representative genome; TAX=7425; STAX=7425; NAME=Nasonia vitripennis; strain=AsymCX; AL=Chromosome; RT=Major
Sequence
MAEEYLYGVTLNGEKNTEVWDPEPKNDESDSNQHFGVDQKLIIKMALLGPEAKAGELNVL
QVEAMGLKGPIKIPIALLEMGKTSQIILDLSFPDPPVTFTLIKGSGPVHIVGHNLLATHM
DEFEDMEDEEVEVDNFDDDDDEKDPEDEDEEDDEPKKKKNK
Download sequence
Identical sequences XP_008204470.2.61660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]