SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008224431.1.13088 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008224431.1.13088
Domain Number 1 Region: 26-106
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0000000017
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0014
Further Details:      
 
Domain Number 2 Region: 108-182
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000955
Family Cold shock DNA-binding domain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008224431.1.13088
Sequence length 211
Comment PREDICTED: DNA-directed RNA polymerase V subunit 7-like isoform X1 [Prunus mume]; AA=GCF_000346735.1; RF=representative genome; TAX=102107; STAX=102107; NAME=Prunus mume; AL=Chromosome; RT=Major
Sequence
MHLLRMDLEVFYKSQMREFFEVDLNMFYEVELLREVAVLAENLDRDKLVSSRFIVTRLLE
GLLSEKADEDLGYFLAVTGIKRIGKGEVVHSSGDVFFPVVFNCRMFLPHKGEILEGVVDH
VHRLGVFLRCGPVKYVFLSARKMPNYRYVVGEKPVFLHDDLARIEKDVVVRFEVFGVRWM
RREDITKEFMMLATLQGDLLGPVTGPDGLDL
Download sequence
Identical sequences XP_008224430.1.13088 XP_008224431.1.13088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]