SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008679834.1.34533 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008679834.1.34533
Domain Number 1 Region: 254-414
Classification Level Classification E-value
Superfamily eEF1-gamma domain 3.27e-61
Family eEF1-gamma domain 0.0000508
Further Details:      
 
Domain Number 2 Region: 80-210
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.78e-29
Family Glutathione S-transferase (GST), C-terminal domain 0.0059
Further Details:      
 
Domain Number 3 Region: 2-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.16e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_008679834.1.34533
Sequence length 414
Comment elongation factor 1-gamma 2 isoform X1 [Zea mays]; AA=GCF_000005005.2; RF=representative genome; TAX=4577; STAX=4577; NAME=Zea mays; cultivar=B73; AL=Chromosome; RT=Major
Sequence
MVLVLHANSGNKNAFKTLIAAEYSGVKVELVKDFQMGVSNKTPEFLKMNPIGKIPVLETP
DGPVFESNAIARYVTRLKADNPLYGSSLIDYAHIEQWIDFAATEIDANIGKWLYPRMGFY
PHAGVVEESTIAALKRALGSLSTHLASNTFLVGHSVTLADIVMTCNLCMGFSRILTKSFT
SEFPHVERYFWTMVNQPNFKKVIGDVKQAEAVPLVPQKAAPAKVQKPKETKKEAPKPKVT
EKSAEEEEAPKPKPKNPLDLLPPSKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYS
LWFCDYKYNDENTVSFVTMNKVGGFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFRGS
EIPKFVMDEVYDMELYEWTKVDLSDEAQKERVNAMIEDQEPFEGEALLDAKCFK
Download sequence
Identical sequences K7UQT7
GRMZM2G134582_T01|PACid:20857781 GRMZM2G320497_T01|PACid:20858739 XP_008679834.1.34533 XP_008679835.1.34533 GRMZM2G134582_P01 GRMZM2G320497_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]