SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008809800.1.81946 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_008809800.1.81946
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 2.75e-22
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0000907
Further Details:      
 
Domain Number 2 Region: 79-169
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.16e-18
Family Cold shock DNA-binding domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008809800.1.81946
Sequence length 177
Comment PREDICTED: DNA-directed RNA polymerase II subunit RPB7 [Phoenix dactylifera]; AA=GCF_000413155.1; RF=representative genome; TAX=42345; STAX=42345; NAME=Phoenix dactylifera; cultivar=Khalas; AL=Scaffold; RT=Major
Sequence
MFFHITLERNMQLHPRHFGPHLREKLVAKLMKDVEGTCSGRHGFVVAITNVEDIGKGLIR
EGTGFVTFPVKYQCVAFRPFKGEILEAVVTMVNKMGFFAEAGPVQIFVSNHLIPDDMEFQ
SGDMPNYTTSDGSVKIQKDSEVRLKIIGTRVDATEIFCIGTIKDDFLGVINDPGAAS
Download sequence
Identical sequences A0A2H3Z8K5
XP_008809800.1.81946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]