SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_008860708.1.50645 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_008860708.1.50645
Domain Number - Region: 2-70
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 0.0902
Family Nucleoplasmin-like core domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_008860708.1.50645
Sequence length 149
Comment hypothetical protein ENU1_213690 [Entamoeba nuttalli P19]; AA=GCF_000257125.1; RF=representative genome; TAX=1076696; STAX=412467; NAME=Entamoeba nuttalli P19; strain=P19; AL=Scaffold; RT=Major
Sequence
MFWNTILKPNQNITFKTNNILHITNASLVSKTKTELKQRTQLFITSGKHKVLIASFIPGI
CEQVRLDLVIGEEIVFSNTGLHYIHLSGFTTELSKPQLEGPEDDDLPELDIVPQVDSENT
NEELTHKKPLKKPKEVKKEDKKLKVCVNY
Download sequence
Identical sequences K2GPV5
XP_008860708.1.50645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]