SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009010123.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009010123.1.102002
Domain Number 1 Region: 671-928
Classification Level Classification E-value
Superfamily NHL repeat 1.7e-29
Family NHL repeat 0.00000041
Further Details:      
 
Domain Number 2 Region: 190-235
Classification Level Classification E-value
Superfamily RING/U-box 0.00000662
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Weak hits

Sequence:  XP_009010123.1.102002
Domain Number - Region: 322-359
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00058
Family B-box zinc-binding domain 0.0076
Further Details:      
 
Domain Number - Region: 262-309
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0285
Family PHD domain 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009010123.1.102002
Sequence length 1075
Comment hypothetical protein HELRODRAFT_166651 [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
MKLICNPQYEYEIRSLEDMDLNNQYISSDEISLPAMSRTNSQTPSPTFSFDTITSQNVSA
YEEKKMMQLQLQQQIQPLLPYPYKCEQSQQQQPQQLPLQPDLWYKSGDQQAHLPQLQKYN
YLLEQQPLQTNVTKSVIGQERNTKLSIKPSAKLPKSSANLQQSSANPQGADKSVNYRNDD
SDMDAWLTPLCCLCSKSSENMFLLSCVHIYCIDCIALHITSNSTNFLCVRCGHLQNFSLP
KGKLARDYTAKNSLQLEKSGIVRRSPEIFENDYTVCRLCKTADQLTAPAIAYCQTCQAGI
CDVCVSVHRHMGNFRNHSYELNYKVRPSECSLHKIIMIGYCWNCEVAICNTCYITKCFPD
QHGVTSMVDKKQLTDIKNKLANHVNAAKNLVPFVTEALRNLHHGKNILMLQDQLINVECL
NPLNDQQSLAERKMFNFCNMKQLELKIDELSRDIPIGGRAILYYERLLRLTDDVGLLSAK
TFLEEKLKSFIHAGYSVLENEMHQKNIEIPYILPIPEGANFNADEQSNMLLCEMSQNFKG
LTVNDGVSNLETVKQEKRNFQIKGRSDLYPTQSSINQDANEAPFNQPKSFKQLTTVNQLF
PSKQKILSKPSSQIWKKPEPTSKINDVFSNADQFQIPDEEIPYYAGKKKILVEGDRVYRI
KLAFVNSFGSGQNPFNDPCGICSNKSGNILIADSNNHKINIFTAEGKFIGHIGSEGKKGD
DRLEYPNRVATCPKTNNIVITERKPSNHIKVFTSDGALVKKFAGPNFIQNARSLCVDGDG
NIIVLESKVNRVSIFDKSGEVVNQFSCPQMSFPMSIAVNDQQELFICDNNSHCVMVYTIS
GEFLRKFGNEVVTQYPVSVKVGQNNEIFVFDNHRNFNATVFDRNGTLLAAYEGRHKHAQV
YDVCLNNDGSISFTGKDYMITTYRLPSRHRLYVKKNYEESGASNDMIADSNAAENMPANI
SNCIIANFNVVVNNISAKYYSDSNSQQQPNRFPLLPTPLSSADFNSNAISKNGTLSNIRN
AISNNSNVISNNSDARSNNNVDSERYQSALSDYSLFSTDTGYISARLTPVLFKFI
Download sequence
Identical sequences T1EYB8
XP_009010123.1.102002 jgi|Helro1|166651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]