SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009016522.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009016522.1.102002
Domain Number 1 Region: 35-450
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 9.29e-56
Family Integrin alpha N-terminal domain 0.00000712
Further Details:      
 
Weak hits

Sequence:  XP_009016522.1.102002
Domain Number - Region: 450-508
Classification Level Classification E-value
Superfamily Integrin domains 0.000319
Family Integrin domains 0.0068
Further Details:      
 
Domain Number - Region: 582-643
Classification Level Classification E-value
Superfamily Integrin domains 0.00068
Family Integrin domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009016522.1.102002
Sequence length 663
Comment hypothetical protein HELRODRAFT_191408 [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
MILTTNEKIPMRHLRDFKISLLIFFLEYFWDTECFNLDVSSATLKRGPPGSYFGYSITPH
KVGHHNSDIIFLVGAPRDNASDPLFSNISRPGVLYNCSFHDENTDCTPLPSFREFVLKDE
DYNDQWFGGVVVSQNIPSGQALACGHKYGKVSSARSETPGWCISLTNNLKPFKFHSPCNL
KHGGYFDYAVCQAGVSAFIDKDGEILLGAPGAHLWRGVVFGGNLRNELDGEEGMSISTSH
NMAKQGRKVYVVGAPRSDNVGEVLLLQKVHAHTFLVKVRLKGQQMGSRFGHKVLVIDVNG
DGYKLDDLVVGAPLYHGVDSCGGAIYVYMSTKATSTASTDQTKNFHDPWFGSDIVSLGDL
DRDDFNDFAVGSPYEGRGRVYIFRGGITGPQHQPSQIIEPSSFQHLFNLSFSSFGFSLAS
NGFDLDSNLHPDLLIGSYLSDAVVLLRSSPVIDIRVSIKNEPKLINPNVNVCGNDKMRGR
NDGVGCFVMRLCFNYYFRKMRKSGKLVLMSHLKSNNSAKHNSSINDSVSQAYFKFYVEKA
NTTPEKLPTAETFSTSSQAPQMKLFNKTTTASSQIIVHTTAKENKDNGNLNCVSHDVYLE
QDNHDYQNGINFHLSYELISFTPLNSSSSSHSHLNPVLSVESSRGLTHVRRSQGELRDPT
PSL
Download sequence
Identical sequences T1FSY6
XP_009016522.1.102002 jgi|Helro1|191408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]