SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009018553.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009018553.1.102002
Domain Number 1 Region: 201-286
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000353
Family DEATH domain, DD 0.0087
Further Details:      
 
Weak hits

Sequence:  XP_009018553.1.102002
Domain Number - Region: 84-171
Classification Level Classification E-value
Superfamily DEATH domain 0.00118
Family DEATH domain, DD 0.019
Further Details:      
 
Domain Number - Region: 34-84
Classification Level Classification E-value
Superfamily BRCA2 tower domain 0.0159
Family BRCA2 tower domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009018553.1.102002
Sequence length 291
Comment hypothetical protein HELRODRAFT_173702 [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
MSTSAVENTKPTNSTSESPASCEEVNYFDYLDYAVVKDAPLDSHLMTMDEEFNSSFERRM
SKIVDTPELKFVQDGDELYKVIKIFQRVAQQMGSEWEPVFLDLVKNHKKEVVEAELKHLE
THKPILRGYRALMVWKELAGSLFHMAKLVDALKVNKMEDIAQEVLFMLYDKVQPQLKQVN
IKPKQSSIRRKRIDVSELDKEPIDNKVLLLIAKKLASEWKKLGEVLGTDENELKEIENQV
GALHEKSFKILWSWKEEAKKSNPESCISDLKTALTKMNRKDVVDECFGDKK
Download sequence
Identical sequences T1F748
jgi|Helro1|173702 XP_009018553.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]