SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009030982.1.102002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_009030982.1.102002
Domain Number - Region: 67-89
Classification Level Classification E-value
Superfamily TAZ domain 0.0759
Family TAZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009030982.1.102002
Sequence length 181
Comment hypothetical protein HELRODRAFT_182467 [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence
MVSDLQNILLVKCDVFGLLEEAWKRKKFVNHRSLSRYDIKLLISIFSSLIQLYFGMAGLQ
RIGCTESHDDTVCNKKRCNERKNLWKHGTKNRRQYLTETQSNKKKDENKARRNTERAILE
LLVNNESVDHPLFVVSLEKEHKVMKIWQVSCHKWDLEDDSCTYFGHIKERGKRCFYCQVY
E
Download sequence
Identical sequences T1FI88
jgi|Helro1|182467 XP_009030982.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]