SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009052894.1.39240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009052894.1.39240
Domain Number 1 Region: 10-142
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.62e-19
Family Fucose binding lectin 0.0032
Further Details:      
 
Weak hits

Sequence:  XP_009052894.1.39240
Domain Number - Region: 152-201
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00902
Family Pan module (APPLE domain) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009052894.1.39240
Sequence length 222
Comment hypothetical protein LOTGIDRAFT_159956 [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence
MSSKLLNEGERRNLVLSKPAIQSSQYLGFVAGRANDGIDGGFTYQGSCSHTAGHSAPAPE
THPWWEVDLLQEYYISAVAISHIYQGSPQLCHDFSIKIYRDGETIDDAVLCYYHVGQPTK
GATGLYWCKTAIKGRHVKVIDSEYLTTTSFTKFDDGDLEFPNMTYSVQGYGQCAMKCYVL
PMCHIFSVKLVSDYYQCNIFTTENPKLIANTTGNPATTVFMI
Download sequence
Identical sequences V4AS47
XP_009052894.1.39240 jgi|Lotgi1|159956|fgenesh2_pg.C_sca_22000167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]