SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009253184.1.42154 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009253184.1.42154
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 2.49e-19
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00022
Further Details:      
 
Domain Number 2 Region: 78-169
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.67e-19
Family Cold shock DNA-binding domain-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009253184.1.42154
Sequence length 172
Comment hypothetical protein FPSE_01790 [Fusarium pseudograminearum CS3096]; AA=GCF_000303195.2; RF=representative genome; TAX=1028729; STAX=101028; NAME=Fusarium pseudograminearum CS3096; strain=CS3096; AL=Chromosome; RT=Major
Sequence
MFFLYNLERKVTLHPSFMGRNMHELVTGKLLKDVEGTCAGSYFIISIMDAFEISEGRILP
GLGMAEFTVGYRAVVWRPFKGETVDAVVHSINPQGFFAHAGPLRLFVSAHLIPNDVKWDP
NATPPQFTNNEDTVIEPQTHVRVKIIGTRTEVGEMWAIGSIKEDYLGCLQAS
Download sequence
Identical sequences A0A2H3FW71 I1RCB7 K3VR12
FGSG_01220T0 XP_009253184.1.42154 XP_011316994.1.100342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]