SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009451009.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009451009.1.37143
Domain Number 1 Region: 102-161
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.84e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009451009.1.37143
Sequence length 166
Comment PREDICTED: fer3-like protein [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MAAYPESCVDTTVLDFVADLSLASPRRPLLCDFAPGVSLGDPALALREGRPRRMARFEEG
DPEEEECEVDQGDGEEEEEEERGRGVSLLGRPKRKRVITYAQRQAANIRERKRMFNLNEA
FDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLESCEKKESG
Download sequence
Identical sequences G3S9M0 H2QU83 Q96RJ6
ENSPTRP00000032392 ENSP00000275461 NP_690862.1.87134 NP_690862.1.92137 XP_004045190.1.27298 XP_009451009.1.37143 ENSGGOP00000024786 gi|23097242|ref|NP_690862.1| 9598.ENSPTRP00000032392 9606.ENSP00000275461 ENSP00000275461 ENSPTRP00000032392 ENSP00000275461 ENSGGOP00000024786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]