SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009541708.1.39223 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_009541708.1.39223
Domain Number - Region: 12-50
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 0.0288
Family FAD-dependent thiol oxidase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009541708.1.39223
Sequence length 110
Comment hypothetical protein HETIRDRAFT_407138 [Heterobasidion irregulare TC 32-1]; AA=GCF_000320585.1; RF=representative genome; TAX=747525; STAX=984962; NAME=Heterobasidion irregulare TC 32-1; strain=TC 32-1; AL=Scaffold; RT=Major
Sequence
MGMSYRRYLAGARVYGCSKCRTHLATIHSMISRAFNGQHGRAYLFEDVVNVVEGEPNDRQ
MTTGNHTVRDIYCCKCQTILGWKYDKAYEPTQRYKEGKFILERNLLVDVQ
Download sequence
Identical sequences W4KS14
XP_009541708.1.39223 jgi|Hetan1|140936|fgenesh3_kg.1__482__1185_1_CCOZ_CCPA_CCPB_CCPC_EXTA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]