SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009592638.1.42874 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009592638.1.42874
Domain Number 1 Region: 117-202
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 1.26e-20
Family tRNA-intron endonuclease catalytic domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_009592638.1.42874
Sequence length 243
Comment PREDICTED: tRNA-splicing endonuclease subunit Sen2-1-like [Nicotiana tomentosiformis]; AA=GCF_000390325.2; RF=representative genome; TAX=4098; STAX=4098; NAME=Nicotiana tomentosiformis; AL=Scaffold; RT=Minor
Sequence
MGPRWKGKGAEVKALADPISEIVGQLQSSLIRSNSRGLLSGTNVLLKADTEQTELLNRAC
FGRPRVTAEKNEQWFQLCMEEAFYLQYSLKCIKVVDHNDTELNSDELWKHITSRKENFPI
LYKAFSHLRSKNWVVRSGSQYGVDFVAYRHHPALVHSEYAVLALSSQHGSANGRLRVWSD
FHCTLRLCGSVAKTLLILDIEQQQSCATSPSCLDNYVVEERTITRWSPEQGREPKVRSDP
SKK
Download sequence
Identical sequences A0A1S3ZDH3
XP_009592637.1.42874 XP_009592638.1.42874 XP_009592639.1.42874 XP_016462456.1.3737 XP_016462457.1.3737 XP_016462458.1.3737 XP_016462459.1.3737 XP_016462460.1.3737 XP_018624083.1.42874 XP_018624084.1.42874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]