SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009610260.1.42874 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009610260.1.42874
Domain Number 1 Region: 258-417
Classification Level Classification E-value
Superfamily eEF1-gamma domain 3.14e-60
Family eEF1-gamma domain 0.0000481
Further Details:      
 
Domain Number 2 Region: 79-209
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.62e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.0044
Further Details:      
 
Domain Number 3 Region: 3-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.58e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_009610260.1.42874
Sequence length 417
Comment PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Nicotiana tomentosiformis]; AA=GCF_000390325.2; RF=representative genome; TAX=4098; STAX=4098; NAME=Nicotiana tomentosiformis; AL=Scaffold; RT=Minor
Sequence
MLQVLHSTNNNKNASKALIAAEYTGVKVELAKNFEMGVSNKTPEFIKMNPIGKVPVLETP
DGPVFESNAIARYVTKSKPDNPLFGSSLIEYAQIEQWNDFSATEIDANIARWLYPRLGYG
AYIPPAEEAAVAALKRALDALNTHLASNTYLVGHSITLADIIMGCNLSIGFRMIMTKSFT
KEFPHVERYFWTVVNQPNFCKILGEVKQADSIPAPLSKKPAPAKELAKPKAKEEPKKEVK
KEEPKFEEEEEAPKPKAKNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPE
GYSLWFCDYKYQDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLF
RGKEIPKFVMDECYDMELYEWKEVDINDEAQKERVNQMIEDYEPFEGEALLDAKCFK
Download sequence
Identical sequences A0A1S3XN07
XP_009610260.1.42874 XP_016441308.1.3737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]