SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_009882643.1.48241 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_009882643.1.48241
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 8.37e-37
Family tRNA-intron endonuclease catalytic domain-like 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_009882643.1.48241
Sequence length 137
Comment PREDICTED: tRNA-splicing endonuclease subunit Sen15 [Charadrius vociferus]; AA=GCF_000708025.1; RF=representative genome; TAX=50402; STAX=50402; NAME=Charadrius vociferus; AL=Scaffold; RT=Major
Sequence
MMSLDISDSAQIYAAFVVYLDLLEGRNWHEVKHVGVAELQLVCLHAREREQDSLQVMVPV
PVHISLSHERIREILKKASLPQDDPDTPLSVTLAIVESDSTVVYYKMTDGFVIPDPPDDT
EDVDNKQWRKKRKKLFK
Download sequence
Identical sequences XP_009882643.1.48241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]