SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010020263.1.70042 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010020263.1.70042
Domain Number 1 Region: 65-105
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.000000000000301
Family p53 tetramerization domain 0.0043
Further Details:      
 
Domain Number 2 Region: 1-31
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.000000024
Family p53 DNA-binding domain-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010020263.1.70042
Sequence length 154
Comment PREDICTED: tumor protein p73-like, partial [Nestor notabilis]; AA=GCF_000696875.1; RF=representative genome; TAX=176057; STAX=176057; NAME=Nestor notabilis; AL=Scaffold; RT=Major
Sequence
GQVLGRRSFEGRICACPGRDRKADEDHYREQQALNESAAKNGSTNKRTFKQSPQGMPALG
AGIKKRRHGEEEMYYVPVRGRENFEILMKIKESLELVELVPQQLVDSYRQQTTQLQAPSS
YGPVLSPMNKVHSGGINKLPSVNQLVGQPSQHGA
Download sequence
Identical sequences XP_010020263.1.70042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]