SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010021808.1.70042 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010021808.1.70042
Domain Number 1 Region: 142-356
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.44e-49
Family Hemopexin-like domain 0.00052
Further Details:      
 
Domain Number 2 Region: 21-66
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000000209
Family Somatomedin B domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010021808.1.70042
Sequence length 360
Comment PREDICTED: vitronectin, partial [Nestor notabilis]; AA=GCF_000696875.1; RF=representative genome; TAX=176057; STAX=176057; NAME=Nestor notabilis; AL=Scaffold; RT=Major
Sequence
MRLLFPTLVLALLTAAHAAEDSCVGRCDDGFDAKRKCQCDTLCVYYQSCCSDYSTVCKAK
VTRGDVFALPEDDYLDYNFTVDLGTTEGPGAALPELPTELPTSLPPAEPTLESKPDPEET
LPEVPSTTQGGFGEPEPVEETEELCSRKPFDAFTDLKNGSLYAFRGKYFYELDETSVRPG
YPKLIRDVWGIEGPIDAAFTRINCEGKTYLFKGSQYWRFDDGVLDPGYPRDISEGFEGIP
NDIDAAFALPAHSYHGNERVYFFKDKYYWSYDFANQPTQADCEKSSPSTVFNHYAFMNRD
SWEDVFQILFGSRMTGSKCETLQSVYFFVGDKYYRVNLRTKRVDLVQPRYPRSIAQYGLA
Download sequence
Identical sequences XP_010021808.1.70042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]