SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010135059.1.100080 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010135059.1.100080
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily PH domain-like 3.58e-35
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000304
Further Details:      
 
Domain Number 2 Region: 342-380
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.000000000000144
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0014
Further Details:      
 
Domain Number 3 Region: 170-311
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000994
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010135059.1.100080
Sequence length 382
Comment PREDICTED: ena/VASP-like protein isoform X2 [Buceros rhinoceros silvestris]; AA=GCF_000710305.1; RF=representative genome; TAX=175836; STAX=175835; NAME=Buceros rhinoceros silvestris; AL=Scaffold; RT=Major
Sequence
MVYDDTSKKWVPIKPGQQGFSRINIYHNTATNTFRVVGVKLQDQQVVINYSIVKGLKYNQ
ATPTFHQWRDARQVYGLNFASKEEATTFSNAMLFALNIMNSQDGGPAAQRQVQNGPSPDE
MEAQRRQVMEQQQQRQESLERRTSTTGPALPPGHPSGTAVIPASSGGPPPPPPPPVPPPT
MGSAPPPPPPLPVGAGQGAGTEDGSVSGLAAALAGAKLRRVQRPEDGSGGSSPSGVSKSD
ANRTSSGGGGGGLMEEMNKLLAKRRKAASQSDKPADKKEEESQNDDASTSPSPSTRGPAQ
QQQNPSDSGKKPWERSNSVEKPVSSLLSRMKPVSSSNDVAMDALDFDRMKQEILEEVVRE
LHKVKEEIIDAIRQELSRISTT
Download sequence
Identical sequences XP_010135059.1.100080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]