SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010157395.1.22856 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010157395.1.22856
Domain Number 1 Region: 66-175
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-31
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 279-386
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.95e-29
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00054
Further Details:      
 
Domain Number 3 Region: 178-276
Classification Level Classification E-value
Superfamily LCCL domain 4.58e-24
Family LCCL domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010157395.1.22856
Sequence length 392
Comment PREDICTED: discoidin, CUB and LCCL domain-containing protein 2-like, partial [Eurypyga helias]; AA=GCF_000690775.1; RF=representative genome; TAX=54383; STAX=54383; NAME=Eurypyga helias; AL=Scaffold; RT=Major
Sequence
MWDHAGLPAATMCSVYVRAVWCFCEEPDLFCGRGWLKHRRRFRGEHTQLISVCSFVGDGC
GHTVLGPESGTLASINYPQTSPNSTVCEWEIRVKPGQRVQLRFGDFDIDDSDSCHSSYLR
VHNGIGPNRTEIGKYCGFGFQMDGLITSKSNEVTVQFMSGTHTSGRGFLAAYSTTDKPDL
ITCLDNASHFSEPEFTKYCPAGCVIPFADTSGTIPHGYRDSSSLCMAGVHAGVVSNTLGG
QINVVISKGIPYYEGSLANNVTSKAGPLSTSLFTFKTSGCYGTLGMESRVIPDSQITASS
VLEWSDQTGEVNIWKPENARLKRAGPPWAAFVSDEHQWLQIGLNKEKRITGIITTGSTLA
EFHYYVSAYRILYSDDAQRWTAYREPGVDKDK
Download sequence
Identical sequences XP_010157395.1.22856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]